PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC618_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 338aa    MW: 37459 Da    PI: 8.7253
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC618_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1253.2e-39194271178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +Cq+e+C+adls+ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk ++
  RrC618_p3 194 RCQAERCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKCHQ 271
                6*************************************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-34189256IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.77192269IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.08E-36193270IPR004333Transcription factor, SBP-box
PfamPF031105.2E-29195268IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MLDYEWDNPS AIMVSGEEQR HHHHHQDLDP TRALSIYEST HTNHHQSSYN NFSPPLFSSL  60
SNQQHLTVLY GHHHHQTAHI PTNQFHHSFY DANPYASSPD SIYHAHSSAS ALFSSFDQTG  120
PAGSGSSSYN FLIPKTEGDV VSRSPLDFST SNRIGLNLGG RTYFSAGDDD FVSRLYRRSR  180
TGELGMGSTT ATPRCQAERC NADLSHAKHY HRRHKVCEFH SKASTVVAAG LSQRFCQQCS  240
RFHLLSEFDN GKRSCRKRLA DHNRRRRKCH QAASASGKHA TDIINTPKSA NDSGLKSSSA  300
SPSPSNAPTT ISLECFRQTT ASSSTSAIWG SLAPTYNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-31185268184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013730442.10.0PREDICTED: squamosa promoter-binding-like protein 8
SwissprotQ8GXL31e-120SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A078HML50.0A0A078HML5_BRANA; BnaCnng09040D protein
STRINGBra033221.1-P1e-138(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70102743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.11e-114squamosa promoter binding protein-like 8